- KLHL17 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85926
- 0.1 ml (also 25ul)
- Human
- KLHL17
- This antibody was developed against Recombinant Protein corresponding to amino acids: AGAWESVAPM NIRRSTHDLV AMDGWLYAVG GNDGSSSLNS IEKYNPRTNK WVAASCMFTR RSSVGVAVLE LLNFPPPSSP TLSVS
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- kelch like family member 17
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- AF
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Unconjugated
Sequence
AGAWESVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRTNKWVAASCMFTRRSSVGVAVLELLNFPPPSSPTLSVS
Specifications/Features
Available conjugates: Unconjugated